ProteaseDB    ProfileDB    CutDB    PathwayDB    SubstrateDB         Log in         


ProfileDB: The PMAP protease specificity database

ProfileDB Record for Phage Data

Protease: MMP-2 (all peptides)
Merops ID: M10.003

Data specific to organism: Homo sapience

Publication details: Boris Ratnikov, Burnham Institute, unpublished

Phage system: M13
Protease concentraion: 50 nM

Structure of the phage and insert: ADVGGTDYKDDDDKPGGRPTWPSSGGSGXXXXXXTASGAETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGA

Proposed specificity motif(s):

Comments:
complete set of 1304 peptide sequences from two experiments, duplicates and "no sequence" removed


Data:

As of April, 2011, the raw data is not available pending publication.