ProfileDB Home         Log in         

PoPS Results

Results for search of PMAP proteome protein hs.25211 by PoPS model 'MMP16_logodds.prts'


Predicted localization (site and confidence): plasma membrane (0.82), ER (0.09), nuclear (0.06)

PositionCleavage sequencePoPS score
N579-M580LANMIS6.129
M493-L494FNMLKK4.567
N492-M493VFNMLK4.465
H533-L534MTHLRV4.301
Q525-I526AAQIRS3.949
M722-L723LVMLKK3.424
Q767-M768FEQMQN3.348
S441-L442VESLEQ3.233
A463-M464VEAMLN3.077
H514-V515FEHVRM3.004




PFAM domainDomain NameStartEndE-value
PF02177Amyloid A4 extracellular domain241881.2e-215
PF00014Kunitz/Bovine pancreatic trypsin inhi2903422.2e-34
PF03494Beta-amyloid peptide (beta-APP)6757133.9e-27


           1         11        21        31        41        51        61        71        
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTKTCIDTKEGILQYCQEVYPEL
    SITES:                                                                                 
 DISORDER:                                                ~~~~~~~~~                        
SECONDARY: ---HHHHHHHHHHHHHHHH---------HHHHHHHHHHHH----EE-------------EEEEE----HHHHHHHH----
  DOMAINS:                        @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


           81        91        101       111       121       131       141       151       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: QITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVGEFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSE
    SITES:                                                                                 
 DISORDER:                                                                                 
SECONDARY: EEEEEEE----EEEE----------------EEEEEE----HHHH---------HHHH---HHHHH----EEEEEE----
  DOMAINS: @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


           161       171       181       191       201       211       221       231       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: KSTNLHDYGMLLPCGIDKFRGVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
    SITES:                                                                                 
 DISORDER:                               ~~~~~~~~~~~~~~~~~~~~                   ~~~~~~~~~~~
SECONDARY: ---------------------EEEEE----------------------EE-------------HHHHHHHHHHHHHHHHH
  DOMAINS: @@@@@@@@@@@@@@@@@@@@@@@@@@@@                                                    


           241       251       261       271       281       291       301       311       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFF
    SITES:                                                                                 
 DISORDER: ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~    ~~~~~~                                        
SECONDARY: ------------HHHHH------------EEEEEEEEEEEEEHHHHHHHH----------HHHHEEEEEE--------EE
  DOMAINS:                                                  @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@


           321       331       341       351       361       371       381       391       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: YGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARDPVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEA
    SITES:                                                                                 
 DISORDER:                                   ~       ~~~~~~~~~~~                           
SECONDARY: E------------HHHHHHH-----HHHHHH--------------------------EE-------HHHHHHHHHHHHHH
  DOMAINS: @@@@@@@@@@@@@@@@@@@@@@                                                          


           401       411       421       431       441       451       461       471       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: KHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
    SITES:                                         *                     *                 
 DISORDER:                   ~~~~~~~~~                                                     
SECONDARY: HHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
  DOMAINS:                                                                                 


           481       491       501       511       521       531       541       551       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQD
    SITES:            **                    *          *       *                           
 DISORDER:                                                                                 
SECONDARY: H--------HHHHHHHHHHHHH--HHHHHHHHHEEEE----HHHHHHHHHHHHHHHHHHH-----HHHH--HHHHHHHHH
  DOMAINS:                                                                                 


           561       571       581       591       601       611       621       631       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: EVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPV
    SITES:                   *                                                             
 DISORDER:                                                                    ~~~~~~~~~~~~~
SECONDARY: HHHHHHHHH-----EEEEEE---------------------EEEEE----------------------------------
  DOMAINS:                                                                                 


           641       651       661       671       681       691       701       711       
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: DARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
    SITES:                                                                                 
 DISORDER: ~~~~ ~~~~~~~~~~~~~                                                              
SECONDARY: ------------------E--HHHHHHHHHHHHHHH-----HHHHHEEEEEEE------EEEEEEEE--EEEEEEEHHHH
  DOMAINS:                                   @@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@@       

           721       731       741       751       761       
           +---------+---------+---------+---------+---------
SUBSTRATE: VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
    SITES:  *                                            *   
 DISORDER:                                 ~~~~~~~~          
SECONDARY: HHHH----EEE---EEEEE-----HHHHHHHHH----------EEE----
  DOMAINS:                                                   



   Top        ProfileDB Home