ProfileDB Home         Log in         

PoPS Results

Results for search of PMAP proteome protein hs.16081 by PoPS model 'MMP16_logodds.prts'


Predicted localization (site and confidence): extracellular (0.86), ER (0.12), plasma membrane (0.01)

PositionCleavage sequencePoPS score
G118-L119SFGLRF4.503
G42-L43SLGLLA0.7205
S70-L71GTSLSP-0.6794
Q37-L38GQQLES-0.7859
S40-L41LESLGL-0.8783
A60-T61PAATAR-1.06
L43-L44LGLLAP-2.01
S91-R92PHSRQI-2.138
Y112-N113PNYNWN-2.402
G35-Q36PTGQQL-2.462




PFAM domainDomain NameStartEndE-value


           1         11        21        31        41        51        61        71        
           +---------+---------+---------+---------+---------+---------+---------+---------
SUBSTRATE: MNSLVSWQLLLFLCATHFGEPLEKVASVGNSRPTGQQLESLGLLAPGEQSLPCTERKPAATARLSRRGTSLSPPPESSGS
    SITES:                                   * *  * **                *         *          
 DISORDER:                          ~~~~~~~~~~                    ~~~~~~~~~~~~~~~~~~~~~~~~~
SECONDARY: ---HHHHHHHHHHHH-------EEEEE--------HHHHHHHH--------------HHHHHHHHH--------------
  DOMAINS:                                                                                 

           81        91        101       111       121       131       141       
           +---------+---------+---------+---------+---------+---------+----
SUBSTRATE: PQQPGLSAPHSRQIPAPQGAVLVQREKDLPNYNWNSFGLRFGKREAAPGNHGRSAGRGWGAGAGQ
    SITES:           *                    *     *                           
 DISORDER: ~~~~~~~~~~~~~                            ~~~~~~~~~~~~~~~~~~~~~~~~
SECONDARY: ------------------EEEEEE-----------------------------------------
  DOMAINS:                                                                  



   Top        ProfileDB Home